PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0114s0030.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 425aa    MW: 47125.8 Da    PI: 4.4452
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0114s0030.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.65.3e-33206262259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+v+k+ver++ d++++ei+Y+++Hnh+
  Kalax.0114s0030.3.p 206 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEVRKQVERTH-DGQITEIVYKSNHNHP 262
                          8***************************************9.***************8 PP

2WRKY22.12.9e-07396410115
                          ---SS-EEEEEEE-- CS
                 WRKY   1 ldDgynWrKYGqKev 15 
                          ldDgy+WrKYGqKe 
  Kalax.0114s0030.3.p 396 LDDGYRWRKYGQKEL 410
                          59***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-29197264IPR003657WRKY domain
PROSITE profilePS5081124.398200264IPR003657WRKY domain
SuperFamilySSF1182903.79E-26202264IPR003657WRKY domain
SMARTSM007741.4E-36205263IPR003657WRKY domain
PfamPF031063.7E-26206262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-8381412IPR003657WRKY domain
SuperFamilySSF1182901.12E-5391412IPR003657WRKY domain
PROSITE profilePS508119.787391408IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MEPPDEYAVE EWNPAAAGSS SSSAPRMNPD PLIDPAVMMI PNSQPSPTTG SYYSPPFNQD  60
LSFLTNSMVA PTAAGGYCDS LPSFHGSEHP AGELNNLHYF KDLETQDLDG GFLNLPSQQL  120
PLEFELPVLS NEFIASASIR NDYIDVDFLS PADLSNAHTT LPLSQPNDHT TSQRNDPMYI  180
DGAADHVMEE EKRASSPRMG GMRTTEDGYN WRKYGQKQVK GSEFPRSYYK CTHPNCEVRK  240
QVERTHDGQI TEIVYKSNHN HPQPMPNRRL TPDSAFAQNE MDAGEGCGGG TSRGKNEGLD  300
RALSEPILTE LSPTGREKRF GAFDSSEAAE LASPPHNHAA EDDEAVEENM ADANEVHNDA  360
TDLRRAEDCM VEPSMSSRGV REQKIVVEIE TEVDILDDGY RWRKYGQKEL LQMHHAWMLG  420
EKTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-172072641674WRKY transcription factor 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.17e-47WRKY family protein